Lineage for d2guya2 (2guy A:1-381)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Fungal alpha-amylases [51462] (2 species) Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (8 PDB entries) 
Domain d2guya2: 2guy A:1-381 [135755]
Other proteins in same PDB: d2guya1
automated match to d7taaa2
complexed with ca
Details for d2guya2
PDB Entry: 2guy (more details), 1.59 Å
PDB Description: orthorhombic crystal structure (space group p21212) of aspergillus niger alpha-amylase at 1.6 a resolution
PDB Compounds: (A:) alpha-amylase ASCOPe Domain Sequences for d2guya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt
SCOPe Domain Coordinates for d2guya2:
Click to download the PDB-style file with coordinates for d2guya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2guya2:
- d2guya2 first appeared in SCOP 1.73
- d2guya2 appears in SCOPe 2.07
View in 3D
