PDB entry 2guy

View 2guy on RCSB PDB site
Description: Orthorhombic crystal structure (space group P21212) of Aspergillus niger alpha-amylase at 1.6 A resolution
Class: hydrolase
Keywords: (beta-alpha) 8 barrel, HYDROLASE
Deposited on 2006-05-02, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase A
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2guya1, d2guya2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2guyA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2guyA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics