SCOP 1.73: Domain d2guya2: 2guy A:1-381

Lineage for d2guya2 (2guy A:1-381)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Fungal alpha-amylases [51462] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (5 PDB entries)

8. Domain d2guya2: 2guy A:1-381 [135755]
   Other proteins in same PDB: d2guya1
   automatically matched to d6taa_2
   complexed with bma, ca, nag

Details for d2guya2

PDB Entry: 2guy, 1.59 Å

PDB Description: orthorhombic crystal structure (space group p21212) of aspergillus niger alpha-amylase at 1.6 a resolution

PDB Compounds: (A:) alpha-amylase A

SCOP Domain Sequences for d2guya2:

Sequence; same for both SEQRES and ATOM records:

>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

Timeline for d2guya2:

• d2guya2 is new in SCOP 1.73
  
• d2guya2 appears in SCOP 1.75
  
• d2guya2 appears in the current release, SCOPe 2.08