Lineage for d2gjka2 (2gjk A:703-908)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2478995Protein Upf1 [346071] (1 species)
    first domain includes small helical insert subdomain
  7. 2478996Species Human (Homo sapiens) [TaxId:9606] [346290] (3 PDB entries)
  8. 2479002Domain d2gjka2: 2gjk A:703-908 [344570]
    Other proteins in same PDB: d2gjka3, d2gjka4
    complexed with anp, mg

Details for d2gjka2

PDB Entry: 2gjk (more details), 2.6 Å

PDB Description: Structural and functional insights into the human Upf1 helicase core
PDB Compounds: (A:) Regulator of nonsense transcripts 1

SCOPe Domain Sequences for d2gjka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjka2 c.37.1.19 (A:703-908) Upf1 {Human (Homo sapiens) [TaxId: 9606]}
rmhpalsafpsnifyegslqngvtaadrvkkgfdfqwpqpdkpmffyvtqgqeeiassgt
sylnrteaanvekittkllkagakpdqigiitpyegqrsylvqymqfsgslhtklyqeve
iasvdafqgrekdfiilscvranehqgigflndprrlnvaltrarygviivgnpkalskq
plwnhllnyykeqkvlvegplnnlre

SCOPe Domain Coordinates for d2gjka2:

Click to download the PDB-style file with coordinates for d2gjka2.
(The format of our PDB-style files is described here.)

Timeline for d2gjka2: