Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.4: Upf1 barrel domain-like [345920] (1 family) barrel topology is 125436 |
Family b.49.4.1: Upf1 barrel domain-like [345963] (2 proteins) |
Protein Upf1 barrel domain [346055] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [346248] (3 PDB entries) |
Domain d2gjka3: 2gjk A:325-415 [344571] Other proteins in same PDB: d2gjka1, d2gjka2, d2gjka4 complexed with anp, mg |
PDB Entry: 2gjk (more details), 2.6 Å
SCOPe Domain Sequences for d2gjka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gjka3 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]} tqdnitvrwdlglnkkriayftlpktdsdmrlmqgdeiclrykgdlaplwkgighvikvp dnygdeiaielrssvgapvevthnfqvdfvw
Timeline for d2gjka3: