SCOPe 2.07: Domain d2gjka3: 2gjk A:325-415

Lineage for d2gjka3 (2gjk A:325-415)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.4: Upf1 barrel domain-like [345920] (1 family)
   barrel topology is 125436

5. Family b.49.4.1: Upf1 barrel domain-like [345963] (2 proteins)

6. Protein Upf1 barrel domain [346055] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [346248] (3 PDB entries)

8. Domain d2gjka3: 2gjk A:325-415 [344571]
   Other proteins in same PDB: d2gjka1, d2gjka2, d2gjka4
   complexed with anp, mg

Details for d2gjka3

PDB Entry: 2gjk, 2.6 Å

PDB Description: Structural and functional insights into the human Upf1 helicase core

PDB Compounds: (A:) Regulator of nonsense transcripts 1

SCOPe Domain Sequences for d2gjka3:

Sequence; same for both SEQRES and ATOM records:

>d2gjka3 b.49.4.1 (A:325-415) Upf1 barrel domain {Human (Homo sapiens) [TaxId: 9606]}
tqdnitvrwdlglnkkriayftlpktdsdmrlmqgdeiclrykgdlaplwkgighvikvp
dnygdeiaielrssvgapvevthnfqvdfvw

Timeline for d2gjka3:

• d2gjka3 is new in SCOPe 2.07-stable
  
• d2gjka3 appears in the current release, SCOPe 2.08