Lineage for d2gfna2 (2gfn A:81-199)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Probable transcriptional regulator RHA1_ro04631 [140899] (1 species) Species Rhodococcus sp. RHA1 [TaxId:101510] [140900] (1 PDB entry)
Uniprot Q0S7R9 81-199
Domain d2gfna2: 2gfn A:81-199 [135102]
Other proteins in same PDB: d2gfna1, d2gfnb1
complexed with cl
Details for d2gfna2
PDB Entry: 2gfn (more details), 1.9 Å
PDB Description: crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
PDB Compounds: (A:) HTH-type transcriptional regulator pksA related proteinSCOPe Domain Sequences for d2gfna2:
Sequence, based on SEQRES records: (download)
>d2gfna2 a.121.1.1 (A:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvresv
vaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr
Sequence, based on observed residues (ATOM records): (download)
>d2gfna2 a.121.1.1 (A:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegtargeiaaflarwrgvvresvvaaq
regtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr
SCOPe Domain Coordinates for d2gfna2:
Click to download the PDB-style file with coordinates for d2gfna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gfna2:
- d2gfna2 first appeared in SCOP 1.73
- d2gfna2 appears in SCOPe 2.07
View in 3D
