PDB entry 2gfn

View 2gfn on RCSB PDB site
Description: Crystal structure of HTH-type transcriptional regulator pksA related protein from Rhodococcus sp. RHA1
Class: transcription
Keywords: hth-type transcriptional regulator, transcriptional regulator tetr, PSI-2, Regulatory protein, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-03-22, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator pksA related protein
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gfna1, d2gfna2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator pksA related protein
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gfnb1, d2gfnb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gfnA (A:)
    vpkivdhderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaa
    lrragdiqgdryrtildeegagpieklrnitasilplderrlamtrvflffyaegaaeet
    argeiaaflarwrgvvresvvaaqregtvstdldadavtvalvaltdglalqaildpvvm
    kaisaedaaarcvdaavrrtteeagavgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfnA (A:)
    ivdhderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaalrr
    agdiqgdryrtildeegagpieklrnitasilplderrlamtrvflffyaegtargeiaa
    flarwrgvvresvvaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaed
    aaarcvdaavrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gfnB (B:)
    vpkivdhderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaa
    lrragdiqgdryrtildeegagpieklrnitasilplderrlamtrvflffyaegaaeet
    argeiaaflarwrgvvresvvaaqregtvstdldadavtvalvaltdglalqaildpvvm
    kaisaedaaarcvdaavrrtteeagavgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfnB (B:)
    hderrraladavlaliaregisavttravaeesgwstgvlnhyfgsrhelllaalrragd
    iqgdryrtildeegagpieklrnitasilplderrlamtrvflffyaegaaeetargeia
    aflarwrgvvresvvaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisae
    daaarcvdaavrr