Lineage for d2gfnb2 (2gfn B:81-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728067Protein Probable transcriptional regulator RHA1_ro04631 [140899] (1 species)
  7. 2728068Species Rhodococcus sp. RHA1 [TaxId:101510] [140900] (1 PDB entry)
    Uniprot Q0S7R9 81-199
  8. 2728070Domain d2gfnb2: 2gfn B:81-199 [135104]
    Other proteins in same PDB: d2gfna1, d2gfnb1
    automated match to d2gfna2
    complexed with cl

Details for d2gfnb2

PDB Entry: 2gfn (more details), 1.9 Å

PDB Description: crystal structure of hth-type transcriptional regulator pksa related protein from rhodococcus sp. rha1
PDB Compounds: (B:) HTH-type transcriptional regulator pksA related protein

SCOPe Domain Sequences for d2gfnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfnb2 a.121.1.1 (B:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}
agpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvresv
vaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr

SCOPe Domain Coordinates for d2gfnb2:

Click to download the PDB-style file with coordinates for d2gfnb2.
(The format of our PDB-style files is described here.)

Timeline for d2gfnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gfnb1