Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Probable transcriptional regulator RHA1_ro04631 [140899] (1 species) |
Species Rhodococcus sp. RHA1 [TaxId:101510] [140900] (1 PDB entry) Uniprot Q0S7R9 81-199 |
Domain d2gfnb2: 2gfn B:81-199 [135104] Other proteins in same PDB: d2gfna1, d2gfnb1 automated match to d2gfna2 complexed with cl |
PDB Entry: 2gfn (more details), 1.9 Å
SCOPe Domain Sequences for d2gfnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfnb2 a.121.1.1 (B:81-199) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]} agpieklrnitasilplderrlamtrvflffyaegaaeetargeiaaflarwrgvvresv vaaqregtvstdldadavtvalvaltdglalqaildpvvmkaisaedaaarcvdaavrr
Timeline for d2gfnb2: