Lineage for d2g43a1 (2g43 A:8-124)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.44: RING/U-box [57849] (1 superfamily)
dimetal(zinc)-bound alpha+beta motif; structurally diverseSuperfamily g.44.1: RING/U-box [57850] (7 families) 
Family g.44.1.5: Zf-UBP [161204] (4 proteins)
Pfam PF02148Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species) Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
Uniprot P45974 169-285
Domain d2g43a1: 2g43 A:8-124 [147081]
complexed with unx, zn
Details for d2g43a1
PDB Entry: 2g43 (more details), 2.09 Å
PDB Description: Structure of the ZNF UBP domain from deubiquitinating enzyme isopeptidase T (IsoT)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5SCOPe Domain Sequences for d2g43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g43a1 g.44.1.5 (A:8-124) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
wdgevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsg
gnnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk
SCOPe Domain Coordinates for d2g43a1:
Click to download the PDB-style file with coordinates for d2g43a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g43a1:
- d2g43a1 first appeared in SCOP 1.75
- d2g43a1 appears in SCOPe 2.07
View in 3D
