SCOP 1.75: Domain d2g43a1: 2g43 A:8-124

Lineage for d2g43a1 (2g43 A:8-124)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (6 families)

5. Family g.44.1.5: Zf-UBP [161204] (3 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries)
   Uniprot P45974 169-285

8. Domain d2g43a1: 2g43 A:8-124 [147081]
   complexed with unx, zn

Details for d2g43a1

PDB Entry: 2g43, 2.09 Å

PDB Description: Structure of the ZNF UBP domain from deubiquitinating enzyme isopeptidase T (IsoT)

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOP Domain Sequences for d2g43a1:

Sequence; same for both SEQRES and ATOM records:

>d2g43a1 g.44.1.5 (A:8-124) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
wdgevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsg
gnnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

Timeline for d2g43a1:

• d2g43a1 is new in SCOP 1.75
  
• d2g43a1 appears in SCOPe 2.01
  
• d2g43a1 appears in the current release, SCOPe 2.08