Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (6 families) |
Family g.44.1.5: Zf-UBP [161204] (3 proteins) Pfam PF02148 |
Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries) Uniprot P45974 169-285 |
Domain d2g43a1: 2g43 A:8-124 [147081] complexed with unx, zn |
PDB Entry: 2g43 (more details), 2.09 Å
SCOP Domain Sequences for d2g43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g43a1 g.44.1.5 (A:8-124) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]} wdgevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsg gnnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk
Timeline for d2g43a1: