SCOPe 2.08: Domain d2g43b_: 2g43 B:

Lineage for d2g43b_ (2g43 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.5: Zf-UBP [161204] (4 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
   Uniprot P45974 169-285

8. Domain d2g43b_: 2g43 B: [147082]
   automated match to d2g43a1
   complexed with unx, zn

Details for d2g43b_

PDB Entry: 2g43, 2.09 Å

PDB Description: Structure of the ZNF UBP domain from deubiquitinating enzyme isopeptidase T (IsoT)

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2g43b_:

Sequence; same for both SEQRES and ATOM records:

>d2g43b_ g.44.1.5 (B:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

Timeline for d2g43b_:

• d2g43b_ first appeared in SCOP 1.75, called d2g43b1
  
• d2g43b_ appears in SCOPe 2.07