Lineage for d2fnec_ (2fne C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538567Protein Multiple PDZ domain protein [141267] (1 species)
  7. 1538568Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
    Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
  8. 1538574Domain d2fnec_: 2fne C: [133815]
    automated match to d2fnea1

Details for d2fnec_

PDB Entry: 2fne (more details), 1.83 Å

PDB Description: The crystal structure of the 13th PDZ domain of MPDZ
PDB Compounds: (C:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2fnec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnec_ b.36.1.1 (C:) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
gtenlyfqsmpqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlk
rgdqiiavngqslegvtheeavailkrtkgtvtlmvlssdetsv

SCOPe Domain Coordinates for d2fnec_:

Click to download the PDB-style file with coordinates for d2fnec_.
(The format of our PDB-style files is described here.)

Timeline for d2fnec_: