Lineage for d2fnec2 (2fne C:1954-2042)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785993Protein Multiple PDZ domain protein [141267] (1 species)
  7. 2785994Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
    Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
  8. 2785998Domain d2fnec2: 2fne C:1954-2042 [133815]
    Other proteins in same PDB: d2fnea2, d2fneb3, d2fneb4, d2fnec3, d2fnec4
    automated match to d2fnea1

Details for d2fnec2

PDB Entry: 2fne (more details), 1.83 Å

PDB Description: The crystal structure of the 13th PDZ domain of MPDZ
PDB Compounds: (C:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2fnec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnec2 b.36.1.1 (C:1954-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
mpqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlkrgdqiiavn
gqslegvtheeavailkrtkgtvtlmvls

SCOPe Domain Coordinates for d2fnec2:

Click to download the PDB-style file with coordinates for d2fnec2.
(The format of our PDB-style files is described here.)

Timeline for d2fnec2: