![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Multiple PDZ domain protein [141267] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries) Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042 |
![]() | Domain d2fnec2: 2fne C:1954-2042 [133815] Other proteins in same PDB: d2fnea2, d2fneb3, d2fneb4, d2fnec3, d2fnec4 automated match to d2fnea1 |
PDB Entry: 2fne (more details), 1.83 Å
SCOPe Domain Sequences for d2fnec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnec2 b.36.1.1 (C:1954-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} mpqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlkrgdqiiavn gqslegvtheeavailkrtkgtvtlmvls
Timeline for d2fnec2: