SCOP 1.73: Domain d2fnec1: 2fne C:1955-2042

Lineage for d2fnec1 (2fne C:1955-2042)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Multiple PDZ domain protein [141267] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141268] (2 PDB entries)

8. Domain d2fnec1: 2fne C:1955-2042 [133815]
   automatically matched to 2FNE A:1955-2042

Details for d2fnec1

PDB Entry: 2fne, 1.83 Å

PDB Description: The crystal structure of the 13th PDZ domain of MPDZ

PDB Compounds: (C:) Multiple PDZ domain protein

SCOP Domain Sequences for d2fnec1:

Sequence; same for both SEQRES and ATOM records:

>d2fnec1 b.36.1.1 (C:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
pqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlkrgdqiiavng
qslegvtheeavailkrtkgtvtlmvls

Timeline for d2fnec1:

• d2fnec1 is new in SCOP 1.73
  
• d2fnec1 appears in SCOP 1.75
  
• d2fnec1 appears in the current release, SCOPe 2.08, called d2fnec2