Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins) accosiated with the C-terminal "winged helix" domain (46785) |
Protein Hypothetical protein EF2700, N-terminal domain [143773] (1 species) includes extra N-terminal alpha-hairpin, separated by a linker peptide |
Species Enterococcus faecalis [TaxId:1351] [143774] (1 PDB entry) Uniprot Q830S2 3-204 |
Domain d2fmla2: 2fml A:3-204 [133779] Other proteins in same PDB: d2fmla1, d2fmlb1 complexed with gol |
PDB Entry: 2fml (more details), 2.26 Å
SCOPe Domain Sequences for d2fmla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} qfaskaeeknyyerqaslaefltwyhqqelpeyekpsltvdmvllcynkeadqlkvlliq rkghpfrnswalpggfvnrnestedsvlretkeetgvvisqenieqlhsfsrpdrdprgw vvtvsylafigeepliagddakevhwfnlerhgqhitlshedveitldlktaaslgkdtl afdhseiiikafnrvvdkmehe
Timeline for d2fmla2: