![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal sequence recognition protein Ffh [47366] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries) |
![]() | Domain d2ffha1: 2ffh A:1-88 [16965] Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3 complexed with cd, so4 |
PDB Entry: 2ffh (more details), 3.2 Å
SCOPe Domain Sequences for d2ffha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffha1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d2ffha1: