Lineage for d2ffhc1 (2ffh C:1-88)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263719Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 1263720Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 1263740Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 1263751Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 1263780Domain d2ffhc1: 2ffh C:1-88 [16967]
    Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3
    complexed with cd, so4

Details for d2ffhc1

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus
PDB Compounds: (C:) protein (ffh)

SCOPe Domain Sequences for d2ffhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffhc1 a.24.13.1 (C:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d2ffhc1:

Click to download the PDB-style file with coordinates for d2ffhc1.
(The format of our PDB-style files is described here.)

Timeline for d2ffhc1: