SCOPe 2.03: Domain d2ffha2: 2ffh A:319-418

Lineage for d2ffha2 (2ffh A:319-418)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47450] (1 PDB entry)

8. Domain d2ffha2: 2ffh A:319-418 [17122]
   Other proteins in same PDB: d2ffha1, d2ffha3, d2ffhb1, d2ffhb3, d2ffhc1, d2ffhc3
   complexed with cd, so4

Details for d2ffha2

PDB Entry: 2ffh, 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

PDB Compounds: (A:) protein (ffh)

SCOPe Domain Sequences for d2ffha2:

Sequence; same for both SEQRES and ATOM records:

>d2ffha2 a.36.1.1 (A:319-418) Signal sequence binding protein Ffh {Thermus aquaticus [TaxId: 271]}
elsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtpeerkdpr
ilngsrrkriakgsgtsvqevnrfikafeemkalmkslek

Timeline for d2ffha2:

• d2ffha2 first appeared (with stable ids) in SCOP 1.55
  
• d2ffha2 appears in SCOPe 2.02
  
• d2ffha2 appears in SCOPe 2.04
  
• d2ffha2 appears in the current release, SCOPe 2.08