Lineage for d2f8ya_ (2f8y A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612496Protein automated matches [190101] (7 species)
    not a true protein
  7. 2612518Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 2612519Domain d2f8ya_: 2f8y A: [164284]
    automated match to d1ot8a_
    complexed with so4

Details for d2f8ya_

PDB Entry: 2f8y (more details), 1.55 Å

PDB Description: Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
PDB Compounds: (A:) Notch homolog 1, translocation-associated (Drosophila)

SCOPe Domain Sequences for d2f8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ya_ d.211.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplha
avsadaqgvfqilirnratdldarmhdgttplilaarlavegmledlinshadvnavddl
gksalhwaaavnnvdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanr
ditdhmdrlprdiaqermhhdivrlldeynlvrsp

SCOPe Domain Coordinates for d2f8ya_:

Click to download the PDB-style file with coordinates for d2f8ya_.
(The format of our PDB-style files is described here.)

Timeline for d2f8ya_: