SCOPe 2.07: Domain d2f8ya_: 2f8y A:

Lineage for d2f8ya_ (2f8y A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (11 PDB entries)

8. Domain d2f8ya_: 2f8y A: [164284]
   automated match to d1ot8a_
   complexed with so4

Details for d2f8ya_

PDB Entry: 2f8y, 1.55 Å

PDB Description: Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.

PDB Compounds: (A:) Notch homolog 1, translocation-associated (Drosophila)

SCOPe Domain Sequences for d2f8ya_:

Sequence; same for both SEQRES and ATOM records:

>d2f8ya_ d.211.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplha
avsadaqgvfqilirnratdldarmhdgttplilaarlavegmledlinshadvnavddl
gksalhwaaavnnvdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanr
ditdhmdrlprdiaqermhhdivrlldeynlvrsp

Timeline for d2f8ya_:

• d2f8ya_ first appeared in SCOPe 2.01
  
• d2f8ya_ appears in SCOPe 2.06