Lineage for d2f2ea1 (2f2e A:5-146)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.69: HxlR-like [140304] (6 proteins)
Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)Protein Hypothetical protein PA1607 [140307] (1 species)
includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimerSpecies Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry)
Uniprot Q9I3B4 5-146
Domain d2f2ea1: 2f2e A:5-146 [132808]
protein/DNA complex; complexed with glc, so4
Details for d2f2ea1
PDB Entry: 2f2e (more details), 1.85 Å
PDB Description: crystal structure of pa1607, a putative transcription factor
PDB Compounds: (A:) pa1607SCOPe Domain Sequences for d2f2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]}
tshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlveh
gvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvp
rlqvragdgsplaaedtrvsrd
SCOPe Domain Coordinates for d2f2ea1:
Click to download the PDB-style file with coordinates for d2f2ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f2ea1:
- d2f2ea1 first appeared in SCOP 1.73
- d2f2ea1 appears in SCOPe 2.07
View in 3D
