Lineage for d2eufa1 (2euf A:8-148)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Viral cyclin [47961] (3 species) 
Species Herpesvirus saimiri [TaxId:10381] [47962] (7 PDB entries) 
Domain d2eufa1: 2euf A:8-148 [132384]
Other proteins in same PDB: d2eufb_
automated match to d2eufa1
complexed with act, ca, dms, lqq
Details for d2eufa1
PDB Entry: 2euf (more details), 3 Å
PDB Description: X-ray structure of human CDK6-Vcyclin in complex with the inhibitor PD0332991
PDB Compounds: (A:) viral CyclinSCOPe Domain Sequences for d2eufa1:
Sequence, based on SEQRES records: (download)
>d2eufa1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf
tnlelinqekdilealkwdte
Sequence, based on observed residues (ATOM records): (download)
>d2eufa1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
elinqekdilealkwdte
SCOPe Domain Coordinates for d2eufa1:
Click to download the PDB-style file with coordinates for d2eufa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2eufa1:
- d2eufa1 first appeared in SCOP 1.73
- d2eufa1 appears in SCOPe 2.03
- d2eufa1 appears in SCOPe 2.05
- d2eufa1 appears in the current release, SCOPe 2.08
View in 3D
