Lineage for d2eufa1 (2euf A:9-148)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273869Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1273870Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1273871Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1274255Protein Viral cyclin [47961] (3 species)
  7. 1274256Species Herpesvirus saimiri [TaxId:10381] [47962] (5 PDB entries)
  8. 1274259Domain d2eufa1: 2euf A:9-148 [132384]
    Other proteins in same PDB: d2eufb1
    automatically matched to d1jowa1
    complexed with act, ca, dms, lqq

Details for d2eufa1

PDB Entry: 2euf (more details), 3 Å

PDB Description: X-ray structure of human CDK6-Vcyclin in complex with the inhibitor PD0332991
PDB Compounds: (A:) viral Cyclin

SCOPe Domain Sequences for d2eufa1:

Sequence, based on SEQRES records: (download)

>d2eufa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcft
nlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records): (download)

>d2eufa1 a.74.1.1 (A:9-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
nrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfel
dksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnle
linqekdilealkwdte

SCOPe Domain Coordinates for d2eufa1:

Click to download the PDB-style file with coordinates for d2eufa1.
(The format of our PDB-style files is described here.)

Timeline for d2eufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eufa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2eufb1