SCOPe 2.08: Domain d2esna1: 2esn A:3-91

Lineage for d2esna1 (2esn A:3-91)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
contains a small beta-sheet (wing)
Family a.4.5.37: LysR-like transcriptional regulators [88979] (2 proteins)
contains long helix in the C-terminal extension; forms dimer similar to the RTP dimer
Protein Probable LysR-type transcriptional regulator PA0477 [140259] (1 species)
Species Pseudomonas aeruginosa [TaxId:287] [140260] (1 PDB entry)
Uniprot Q9I641 3-91
Domain d2esna1: 2esn A:3-91 [132333]
Other proteins in same PDB: d2esna2, d2esnb2, d2esnc2, d2esnd2

Details for d2esna1

PDB Entry: 2esn (more details), 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa

PDB Compounds: (A:) probable transcriptional regulator

SCOPe Domain Sequences for d2esna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esna1 a.4.5.37 (A:3-91) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
pllrrldlnlllvfdalyrhrnvgtaaselaisasafshalgrlrqglddelflrqgnrm
qptqraehlaaavaaalralgegleewrp

SCOPe Domain Coordinates for d2esna1:

Click to download the PDB-style file with coordinates for d2esna1.
(The format of our PDB-style files is described here.)

Timeline for d2esna1: