Lineage for d2esnd2 (2esn D:92-303)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145128Protein Probable LysR-type transcriptional regulator PA0477 [142812] (1 species)
  7. 2145129Species Pseudomonas aeruginosa [TaxId:287] [142813] (1 PDB entry)
    Uniprot Q9I641 92-303
  8. 2145133Domain d2esnd2: 2esn D:92-303 [132340]
    Other proteins in same PDB: d2esna1, d2esnb1, d2esnc1, d2esnd1
    automated match to d2esna2

Details for d2esnd2

PDB Entry: 2esn (more details), 2.1 Å

PDB Description: the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa
PDB Compounds: (D:) probable transcriptional regulator

SCOPe Domain Sequences for d2esnd2:

Sequence, based on SEQRES records: (download)

>d2esnd2 c.94.1.1 (D:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqhvgrdahawmigqlkgld

Sequence, based on observed residues (ATOM records): (download)

>d2esnd2 c.94.1.1 (D:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}
fvpgqsqrtfvfaatdytafallpplmnrlqhsapgvrlrlvnaerklsvealasgridf
algydeeherlpegiqahdwfadryvvvarrdhprlagaptlegylaerhavvtpwneds
gvidrllarsglrrevavqlptvlaalflagstdflltaprhaaralaeaaglalypapf
dippyvlrlyshvqrdahawmigqlkgld

SCOPe Domain Coordinates for d2esnd2:

Click to download the PDB-style file with coordinates for d2esnd2.
(The format of our PDB-style files is described here.)

Timeline for d2esnd2: