![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.247: YoaC-like [140669] (1 superfamily) 5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214) |
![]() | Superfamily a.247.1: YoaC-like [140670] (1 family) ![]() automatically mapped to Pfam PF08986 |
![]() | Family a.247.1.1: YoaC-like [140671] (2 proteins) |
![]() | Protein Hypothetical protein YoaC [140672] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [140673] (1 PDB entry) Uniprot Q8ZRJ2 11-107 STM0327 |
![]() | Domain d2es9a1: 2es9 A:11-107 [132318] Other proteins in same PDB: d2es9a2 |
PDB Entry: 2es9 (more details), 2 Å
SCOPe Domain Sequences for d2es9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 90371]} taiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpef tkkvagwaekvasgnriliknpeyfstymqeqlkelv
Timeline for d2es9a1: