PDB entry 2es9

View 2es9 on RCSB PDB site
Description: Crystal structure of Q8ZRJ2 from salmonella typhimurium. NESG TARGET STR65
Class: structural genomics, unknown function
Keywords: structural genomics, psi, protein structure initiative, northeast structural genomics consortium, nesg, unknown function
Deposited on 2005-10-25, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.242
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRJ2 (Start-106)
      • modified residue (22)
      • modified residue (32)
      • modified residue (98)
      • cloning artifact (107-108)
      • expression tag (109)
    Domains in SCOPe 2.08: d2es9a1, d2es9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2es9A (A:)
    mvnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvar
    geqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2es9A (A:)
    taiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpef
    tkkvagwaekvasgnriliknpeyfstymqeqlkelvleh