Lineage for d2es9a1 (2es9 A:11-107)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651701Fold a.247: YoaC-like [140669] (1 superfamily)
    5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (scop_cf 101214)
  4. 651702Superfamily a.247.1: YoaC-like [140670] (1 family) (S)
  5. 651703Family a.247.1.1: YoaC-like [140671] (1 protein)
  6. 651704Protein Hypothetical protein YoaC [140672] (1 species)
  7. 651705Species Salmonella typhimurium [TaxId:90371] [140673] (1 PDB entry)
    STM0327
  8. 651706Domain d2es9a1: 2es9 A:11-107 [132318]

Details for d2es9a1

PDB Entry: 2es9 (more details), 2 Å

PDB Description: crystal structure of q8zrj2 from salmonella typhimurium. nesg target str65
PDB Compounds: (A:) putative cytoplasmic protein

SCOP Domain Sequences for d2es9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 602]}
taiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpef
tkkvagwaekvasgnriliknpeyfstymqeqlkelv

SCOP Domain Coordinates for d2es9a1:

Click to download the PDB-style file with coordinates for d2es9a1.
(The format of our PDB-style files is described here.)

Timeline for d2es9a1: