Lineage for d2d4ca1 (2d4c A:11-247)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries)
    Uniprot Q99962 11-247! Uniprot Q99962 26-247
  8. Domain d2d4ca1: 2d4c A:11-247 [131246]
    Other proteins in same PDB: d2d4cb_, d2d4cc_, d2d4cd_
    complexed with ca; mutant

Details for d2d4ca1

PDB Entry: 2d4c (more details), 2.4 Å

PDB Description: Crystal structure of the endophilin BAR domain mutant
PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d2d4ca1:

Sequence, based on SEQRES records: (download)

>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsm
intmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkds
ldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqa
lekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer

Sequence, based on observed residues (ATOM records): (download)

>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklyp
qaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnlh
dkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfn
llemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer

SCOPe Domain Coordinates for d2d4ca1 are not available.

Timeline for d2d4ca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d4cb_, d2d4cc_, d2d4cd_