Lineage for d2d4cd_ (2d4c D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738000Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. 2738017Protein automated matches [190594] (1 species)
    not a true protein
  7. 2738018Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries)
  8. 2738022Domain d2d4cd_: 2d4c D: [131249]
    Other proteins in same PDB: d2d4ca1
    automated match to d2d4ca1
    complexed with ca; mutant

Details for d2d4cd_

PDB Entry: 2d4c (more details), 2.4 Å

PDB Description: Crystal structure of the endophilin BAR domain mutant
PDB Compounds: (D:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d2d4cd_:

Sequence, based on SEQRES records: (download)

>d2d4cd_ a.238.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
katqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmi
ntmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsl
dievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqal
ekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa

Sequence, based on observed residues (ATOM records): (download)

>d2d4cd_ a.238.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
katqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmy
pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnl
hdkdlreiqsalqhhlkklegrrldfdipdeelrqalekfdeskeiaessmfnllemdie
qvsqlsalvqaqleyhkqavqilqqvtvrleerirqa

SCOPe Domain Coordinates for d2d4cd_:

Click to download the PDB-style file with coordinates for d2d4cd_.
(The format of our PDB-style files is described here.)

Timeline for d2d4cd_: