![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
![]() | Protein automated matches [190594] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries) |
![]() | Domain d2d4cc_: 2d4c C: [131248] Other proteins in same PDB: d2d4ca1 automated match to d2d4ca1 complexed with ca; mutant |
PDB Entry: 2d4c (more details), 2.4 Å
SCOPe Domain Sequences for d2d4cc_:
Sequence, based on SEQRES records: (download)
>d2d4cc_ a.238.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsm intmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkds ldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqa lekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirq a
>d2d4cc_ a.238.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklpg ypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqn lhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessm fnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
Timeline for d2d4cc_: