Lineage for d2ckxa1 (2ckx A:578-660)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720667Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1720749Protein Telomere binding protein TBP1 [158244] (1 species)
  7. 1720750Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries)
    Uniprot Q84ZU4 578-660
  8. 1720751Domain d2ckxa1: 2ckx A:578-660 [146411]

Details for d2ckxa1

PDB Entry: 2ckx (more details), 1.9 Å

PDB Description: crystal structure of ngtrf1, double-stranded telomeric repeat binding factor from nicotiana tabacum.
PDB Compounds: (A:) telomere binding protein tbp1

SCOPe Domain Sequences for d2ckxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr
rgepvpqdlldrvlaahaywsqq

SCOPe Domain Coordinates for d2ckxa1:

Click to download the PDB-style file with coordinates for d2ckxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ckxa1: