| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein Telomere binding protein TBP1 [158244] (1 species) |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries) Uniprot Q84ZU4 578-660 |
| Domain d2ckxa1: 2ckx A:578-660 [146411] |
PDB Entry: 2ckx (more details), 1.9 Å
SCOPe Domain Sequences for d2ckxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr
rgepvpqdlldrvlaahaywsqq
Timeline for d2ckxa1: