Lineage for d2c2ia1 (2c2i A:2-150)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.4: MaoC-like [82636] (6 proteins) 
Protein Hypothetical protein Rv0130 [143173] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [143174] (1 PDB entry)
Uniprot P96807 2-150
Domain d2c2ia1: 2c2i A:2-150 [129670]
Details for d2c2ia1
PDB Entry: 2c2i (more details), 1.8 Å
PDB Description: structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis
PDB Compounds: (A:) rv0130SCOPe Domain Sequences for d2c2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]}
rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
tvqatvsttvevegsakpacvaesivryv
SCOPe Domain Coordinates for d2c2ia1:
Click to download the PDB-style file with coordinates for d2c2ia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c2ia1:
- d2c2ia1 first appeared in SCOP 1.73
- d2c2ia1 appears in SCOPe 2.07
View in 3D
