Lineage for d2c2ib_ (2c2i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943777Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2943832Protein Hypothetical protein Rv0130 [143173] (1 species)
  7. 2943833Species Mycobacterium tuberculosis [TaxId:1773] [143174] (1 PDB entry)
    Uniprot P96807 2-150
  8. 2943835Domain d2c2ib_: 2c2i B: [129671]
    automated match to d2c2ia1

Details for d2c2ib_

PDB Entry: 2c2i (more details), 1.8 Å

PDB Description: structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis
PDB Compounds: (B:) rv0130

SCOPe Domain Sequences for d2c2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2ib_ d.38.1.4 (B:) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]}
rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
tvqatvsttvevegsakpacvaesivryv

SCOPe Domain Coordinates for d2c2ib_:

Click to download the PDB-style file with coordinates for d2c2ib_.
(The format of our PDB-style files is described here.)

Timeline for d2c2ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c2ia1