SCOP 1.73: Domain d2c2ia1: 2c2i A:2-150

Lineage for d2c2ia1 (2c2i A:2-150)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein Hypothetical protein Rv0130 [143173] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143174] (1 PDB entry)

8. Domain d2c2ia1: 2c2i A:2-150 [129670]

Details for d2c2ia1

PDB Entry: 2c2i, 1.8 Å

PDB Description: structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis

PDB Compounds: (A:) rv0130

SCOP Domain Sequences for d2c2ia1:

Sequence; same for both SEQRES and ATOM records:

>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]}
rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
tvqatvsttvevegsakpacvaesivryv

Timeline for d2c2ia1:

• d2c2ia1 is new in SCOP 1.73
  
• d2c2ia1 appears in SCOP 1.75
  
• d2c2ia1 appears in the current release, SCOPe 2.08