PDB entry 2c2i

View 2c2i on RCSB PDB site
Description: structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis
Class: lyase
Keywords: rv0130, tuberculosis, conserved hypothetical protein, hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics
Deposited on 2005-09-29, released 2006-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rv0130
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c2ia1
  • Chain 'B':
    Compound: rv0130
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c2ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2iA (A:)
    mrtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgtti
    ahgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgn
    gtvqatvsttvevegsakpacvaesivryva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2iA (A:)
    rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
    hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
    tvqatvsttvevegsakpacvaesivryv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2iB (B:)
    mrtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgtti
    ahgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgn
    gtvqatvsttvevegsakpacvaesivryva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2iB (B:)
    rtfesvadlaaaagekvgqsdwvtitqeevnlfadatgdhqwihvdperaaagpfgttia
    hgfmtlallprlqhqmytvkgvklainyglnkvrfpapvpvgsrvratsslvgvedlgng
    tvqatvsttvevegsakpacvaesivryv