Lineage for d2c0za1 (2c0z A:1-190)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topologySuperfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) 
Protein Novobiocin biosynthesis protein NovW [141587] (1 species) Species Streptomyces caeruleus [TaxId:195949] [141588] (1 PDB entry)
Uniprot Q9L9E5 1-190
Domain d2c0za1: 2c0z A:1-190 [129615]
Other proteins in same PDB: d2c0za2
complexed with edo, so4
Details for d2c0za1
PDB Entry: 2c0z (more details), 1.6 Å
PDB Description: The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides
PDB Compounds: (A:) novwSCOPe Domain Sequences for d2c0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}
mrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanlsvsvrgvvrg
ihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrravylsegighg
fcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqdalllaearda
gllptyatcq
SCOPe Domain Coordinates for d2c0za1:
Click to download the PDB-style file with coordinates for d2c0za1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c0za1:
- d2c0za1 first appeared in SCOP 1.73
- d2c0za1 appears in SCOPe 2.06
- d2c0za1 appears in the current release, SCOPe 2.08
View in 3D
