| Class b: All beta proteins [48724] (165 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (20 families) ![]() |
| Family b.82.1.1: dTDP-sugar isomerase [51183] (3 proteins) |
| Protein Novobiocin biosynthesis protein NovW [141587] (1 species) |
| Species Streptomyces caeruleus [TaxId:195949] [141588] (1 PDB entry) |
| Domain d2c0za1: 2c0z A:1-190 [129615] complexed with edo, so4 |
PDB Entry: 2c0z (more details), 1.6 Å
SCOP Domain Sequences for d2c0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}
mrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanlsvsvrgvvrg
ihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrravylsegighg
fcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqdalllaearda
gllptyatcq
Timeline for d2c0za1: