SCOPe 2.08: Domain d2c0za1: 2c0z A:1-190

Lineage for d2c0za1 (2c0z A:1-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein Novobiocin biosynthesis protein NovW [141587] (1 species)

7. Species Streptomyces caeruleus [TaxId:195949] [141588] (1 PDB entry)
   Uniprot Q9L9E5 1-190

8. Domain d2c0za1: 2c0z A:1-190 [129615]
   Other proteins in same PDB: d2c0za2
   complexed with edo, so4

Details for d2c0za1

PDB Entry: 2c0z, 1.6 Å

PDB Description: The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides

PDB Compounds: (A:) novw

SCOPe Domain Sequences for d2c0za1:

Sequence; same for both SEQRES and ATOM records:

>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]}
mrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanlsvsvrgvvrg
ihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrravylsegighg
fcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqdalllaearda
gllptyatcq

Timeline for d2c0za1:

• d2c0za1 first appeared in SCOP 1.73
  
• d2c0za1 appears in SCOPe 2.07