Lineage for d2bh1a2 (2bh1 A:2-145)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.11: Cyto-EpsL domain [117644] (2 proteins)
    N-terminal part of Pfam PF05134
  6. Protein automated matches [254487] (1 species)
    not a true protein
  7. Species Vibrio cholerae [TaxId:666] [255052] (1 PDB entry)
  8. 2492496Domain d2bh1a2: 2bh1 A:2-145 [128507]
    Other proteins in same PDB: d2bh1a1, d2bh1b1, d2bh1x1, d2bh1y_
    automated match to d2bh1a2
    complexed with ca

Details for d2bh1a2

PDB Entry: 2bh1 (more details), 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
PDB Compounds: (A:) general secretion pathway protein l

SCOPe Domain Sequences for d2bh1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh1a2 c.55.1.11 (A:2-145) automated matches {Vibrio cholerae [TaxId: 666]}
sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd
liltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrlwlrac
ldhlkacgfdvkrvlpdvlaiprp

SCOPe Domain Coordinates for d2bh1a2:

Click to download the PDB-style file with coordinates for d2bh1a2.
(The format of our PDB-style files is described here.)

Timeline for d2bh1a2:

2492496
d2bh1a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2bh1a1