SCOP 1.73: Domain d2bh1a2: 2bh1 A:2-145

Lineage for d2bh1a2 (2bh1 A:2-145)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.11: Cyto-EpsL domain [117644] (1 protein)
   N-terminal part of Pfam PF05134

6. Protein Cytoplasmic domain of general secretion pathway protein L, EpsL [117645] (1 species)

7. Species Vibrio cholerae [TaxId:666] [117646] (3 PDB entries)

8. Domain d2bh1a2: 2bh1 A:2-145 [128507]
   automatically matched to 1YF5 L:2-145
   complexed with ca

Details for d2bh1a2

PDB Entry: 2bh1, 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae

PDB Compounds: (A:) general secretion pathway protein l

SCOP Domain Sequences for d2bh1a2:

Sequence; same for both SEQRES and ATOM records:

>d2bh1a2 c.55.1.11 (A:2-145) Cytoplasmic domain of general secretion pathway protein L, EpsL {Vibrio cholerae [TaxId: 666]}
sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd
liltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrlwlrac
ldhlkacgfdvkrvlpdvlaiprp

Timeline for d2bh1a2:

• d2bh1a2 is new in SCOP 1.73
  
• d2bh1a2 appears in SCOP 1.75
  
• d2bh1a2 appears in the current release, SCOPe 2.08