Lineage for d2b6ca1 (2b6c A:3-215)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (27 families) 
Family a.118.1.17: BC3264-like [109965] (3 proteins)
Pfam PF06352; DUF1061
this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain
Protein Hypothetical protein EF3068 [140817] (1 species)
assigned by a closer overall structural similarity to BC3264; predicted DNA alkylation repair enzymeSpecies Enterococcus faecalis [TaxId:1351] [140818] (1 PDB entry)
Uniprot Q82ZI8 3-215
Domain d2b6ca1: 2b6c A:3-215 [127983]
complexed with bme, cl, gol, so4
Details for d2b6ca1
PDB Entry: 2b6c (more details), 2.1 Å
PDB Description: Predicted DNA alkylation repair enzyme from Enterococcus faecalis.
PDB Compounds: (A:) hypothetical protein EF3068SCOPe Domain Sequences for d2b6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]}
tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
ysktnpqwveelmkelvlsplaqregskylaka
SCOPe Domain Coordinates for d2b6ca1:
Click to download the PDB-style file with coordinates for d2b6ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b6ca1:
- d2b6ca1 first appeared in SCOP 1.73
- d2b6ca1 appears in SCOPe 2.06
- d2b6ca1 appears in the current release, SCOPe 2.08
View in 3D
