SCOPe 2.07: Domain d2b6cb_: 2b6c B:

Lineage for d2b6cb_ (2b6c B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.17: BC3264-like [109965] (3 proteins)
   Pfam PF06352; DUF1061
   this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain

6. Protein Hypothetical protein EF3068 [140817] (1 species)
   assigned by a closer overall structural similarity to BC3264; predicted DNA alkylation repair enzyme

7. Species Enterococcus faecalis [TaxId:1351] [140818] (1 PDB entry)
   Uniprot Q82ZI8 3-215

8. Domain d2b6cb_: 2b6c B: [127984]
   automated match to d2b6ca1
   complexed with bme, cl, gol, so4

Details for d2b6cb_

PDB Entry: 2b6c, 2.1 Å

PDB Description: Predicted DNA alkylation repair enzyme from Enterococcus faecalis.

PDB Compounds: (B:) hypothetical protein EF3068

SCOPe Domain Sequences for d2b6cb_:

Sequence; same for both SEQRES and ATOM records:

>d2b6cb_ a.118.1.17 (B:) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]}
tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
ysktnpqwveelmkelvlsplaqregskylakase

Timeline for d2b6cb_:

• d2b6cb_ first appeared in SCOP 1.73, called d2b6cb1
  
• d2b6cb_ appears in SCOPe 2.06
  
• d2b6cb_ appears in the current release, SCOPe 2.08