PDB entry 2b6c

View 2b6c on RCSB PDB site
Description: Predicted DNA alkylation repair enzyme from Enterococcus faecalis.
Class: structural genomics, unknown function
Keywords: structural genomis, DNA repair enzyme, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-09-30, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein EF3068
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF3068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZI8
      • modified residue (18)
      • modified residue (22)
      • modified residue (149)
      • modified residue (197)
    Domains in SCOPe 2.07: d2b6ca1
  • Chain 'B':
    Compound: hypothetical protein EF3068
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: EF3068
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZI8 (Start-219)
      • modified residue (18)
      • modified residue (22)
      • modified residue (149)
      • modified residue (197)
    Domains in SCOPe 2.07: d2b6cb_
  • Heterogens: SO4, CL, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b6cA (A:)
    snamdtlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqei
    eayyqktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswval
    hltelptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaig
    wslrqysktnpqwveelmkelvlsplaqregskylakase
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6cA (A:)
    tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
    ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
    ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
    ysktnpqwveelmkelvlsplaqregskylaka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b6cB (B:)
    snamdtlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqei
    eayyqktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswval
    hltelptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaig
    wslrqysktnpqwveelmkelvlsplaqregskylakase
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6cB (B:)
    tlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqeieayyq
    ktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswvalhltel
    ptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaigwslrq
    ysktnpqwveelmkelvlsplaqregskylakase