Lineage for d2b33a1 (2b33 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the restSuperfamily d.79.1: YjgF-like [55298] (4 families) 
forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
some members possess an endoribonuclease activity inhibiting mRNA translation
Protein Putative protein synthesis inhibitor TM0215 [143525] (1 species) Species Thermotoga maritima [TaxId:2336] [143526] (1 PDB entry)
Uniprot Q9WY58 2-127
Domain d2b33a1: 2b33 A: [127765]
complexed with ca, edo
Details for d2b33a1
PDB Entry: 2b33 (more details), 2.3 Å
PDB Description: crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
PDB Compounds: (A:) protein synthesis inhibitor, putativeSCOPe Domain Sequences for d2b33a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b33a1 d.79.1.1 (A:) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]}
mkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlka
ileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieie
aiavkeg
SCOPe Domain Coordinates for d2b33a1:
Click to download the PDB-style file with coordinates for d2b33a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b33a1:
- d2b33a1 first appeared in SCOP 1.73
- d2b33a1 appears in SCOPe 2.07
View in 3D
