PDB entry 2b33

View 2b33 on RCSB PDB site
Description: crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
Class: hydrolase
Keywords: protein synthesis inhibitor, putative endoribonuclease, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, hydrolase
Deposited on 2005-09-19, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein synthesis inhibitor, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b33a1
  • Chain 'B':
    Compound: protein synthesis inhibitor, putative
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b33b_
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b33A (A:)
    mgsdkihhhhhhmkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtie
    ektervlenlkaileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvav
    aqlprnveieieaiavkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b33A (A:)
    mkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlka
    ileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieie
    aiavkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b33B (B:)
    mgsdkihhhhhhmkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtie
    ektervlenlkaileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvav
    aqlprnveieieaiavkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b33B (B:)
    krfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkai
    leaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieiea
    iavkeg