Lineage for d2b33b_ (2b33 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525087Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2525164Protein Putative protein synthesis inhibitor TM0215 [143525] (1 species)
  7. 2525165Species Thermotoga maritima [TaxId:2336] [143526] (1 PDB entry)
    Uniprot Q9WY58 2-127
  8. 2525167Domain d2b33b_: 2b33 B: [127766]
    automated match to d2b33a1
    complexed with ca, edo

Details for d2b33b_

PDB Entry: 2b33 (more details), 2.3 Å

PDB Description: crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
PDB Compounds: (B:) protein synthesis inhibitor, putative

SCOPe Domain Sequences for d2b33b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b33b_ d.79.1.1 (B:) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]}
krfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkai
leaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieiea
iavkeg

SCOPe Domain Coordinates for d2b33b_:

Click to download the PDB-style file with coordinates for d2b33b_.
(The format of our PDB-style files is described here.)

Timeline for d2b33b_: