![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
![]() | Protein Putative protein synthesis inhibitor TM0215 [143525] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [143526] (1 PDB entry) Uniprot Q9WY58 2-127 |
![]() | Domain d2b33b_: 2b33 B: [127766] automated match to d2b33a1 complexed with ca, edo |
PDB Entry: 2b33 (more details), 2.3 Å
SCOPe Domain Sequences for d2b33b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b33b_ d.79.1.1 (B:) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]} krfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkai leaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieiea iavkeg
Timeline for d2b33b_: