Lineage for d2aw6a2 (2aw6 A:70-287)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (10 families) 
Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) Protein PrgX [140849] (1 species) Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
Uniprot Q04114 70-287! Uniprot Q04114 71-301
Domain d2aw6a2: 2aw6 A:70-287 [127409]
Other proteins in same PDB: d2aw6a1, d2aw6b1, d2aw6b2
protein/DNA complex
Details for d2aw6a2
PDB Entry: 2aw6 (more details), 3 Å
PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
PDB Compounds: (A:) PrgXSCOPe Domain Sequences for d2aw6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw6a2 a.118.8.4 (A:70-287) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisake
SCOPe Domain Coordinates for d2aw6a2:
Click to download the PDB-style file with coordinates for d2aw6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aw6a2:
- d2aw6a2 first appeared in SCOP 1.73
- d2aw6a2 appears in SCOPe 2.06
- d2aw6a2 appears in the current release, SCOPe 2.08
View in 3D
