Lineage for d2aw6a2 (2aw6 A:70-287)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647383Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 647384Protein PrgX [140849] (1 species)
  7. 647385Species Enterococcus faecalis [TaxId:1351] [140850] (6 PDB entries)
  8. 647410Domain d2aw6a2: 2aw6 A:70-287 [127409]
    Other proteins in same PDB: d2aw6a1, d2aw6b1

Details for d2aw6a2

PDB Entry: 2aw6 (more details), 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
PDB Compounds: (A:) PrgX

SCOP Domain Sequences for d2aw6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw6a2 a.118.8.4 (A:70-287) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisake

SCOP Domain Coordinates for d2aw6a2:

Click to download the PDB-style file with coordinates for d2aw6a2.
(The format of our PDB-style files is described here.)

Timeline for d2aw6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aw6a1